Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD5 Rabbit pAb
E47R8145 100 µL

CHCHD5 Rabbit pAb

Sign In for Pricing
View Details
5- (4-Bromophenyl) -1-methylimidazole
434435-01 10 mg

5- (4-Bromophenyl) -1-methylimidazole

Sign In for Pricing
View Details
5- (4-Bromophenyl) -1-methylimidazole
434435-02 25 mg

5- (4-Bromophenyl) -1-methylimidazole

Sign In for Pricing
View Details
Ddt Recombinant Protein
OPCA01558-1MG 1 mg

Ddt Recombinant Protein

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody [Clone ID: LBI4E5]
AMM16437V 100 µL

MDM2 Mouse Monoclonal Antibody [Clone ID: LBI4E5]

Sign In for Pricing
View Details
Lentiviral mouse Sec23b shRNA (UAS) - Lentiviral mouse Sec23b shRNA (UAS) (100)
GTR15248922 1 Vial

Lentiviral mouse Sec23b shRNA (UAS) - Lentiviral mouse Sec23b shRNA (UAS) (100)

Sign In for Pricing
View Details