Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

T-2 (T-2 Toxin) Lateral Flow Assay Kit
E-TO-C012-01 80 Tests

T-2 (T-2 Toxin) Lateral Flow Assay Kit

Ask
View Details
T-2 (T-2 Toxin) Lateral Flow Assay Kit
E-TO-C012-02 20 Tests

T-2 (T-2 Toxin) Lateral Flow Assay Kit

Ask
View Details
T-2 (T-2 Toxin) Lateral Flow Assay Kit
E-TO-C012-03 50 Tests

T-2 (T-2 Toxin) Lateral Flow Assay Kit

Ask
View Details
LRS1 CRISPRa sgRNA lentivector (set of three targets)(Human)
61357121 3x 1.0µg DNA

LRS1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Rat Monoclonal CD161/NK1.1 Antibody (694370) [DyLight 650]
FAB7614W 0.1 mL

Rat Monoclonal CD161/NK1.1 Antibody (694370) [DyLight 650]

Ask
View Details
PCBP4 Antibody
GWB-37C648 0.1 mg

PCBP4 Antibody

Ask
View Details