Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal TrkA Antibody (165131R) [DyLight 350]
FAB1751RD 0.1 mL

Mouse Monoclonal TrkA Antibody (165131R) [DyLight 350]

Ask
View Details
pGEX-5X-3 Plasmid
PVT0211 2 µg

pGEX-5X-3 Plasmid

Ask
View Details
Acyloxyacyl Hydrolase (AOAH) (NM_001637) Human Tagged Lenti ORF Clone
RC206619L3 10 µg

Acyloxyacyl Hydrolase (AOAH) (NM_001637) Human Tagged Lenti ORF Clone

Ask
View Details
Olfr657 (NM_146312) Mouse Tagged ORF Clone
MR214900 10 µg

Olfr657 (NM_146312) Mouse Tagged ORF Clone

Ask
View Details
Recombinant Desulfotalea psychrophila Protein CrcB homolog (crcB)
MBS7012616-01 0.02 mg

Recombinant Desulfotalea psychrophila Protein CrcB homolog (crcB)

Ask
View Details
Recombinant Desulfotalea psychrophila Protein CrcB homolog (crcB)
MBS7012616-02 0.1 mg

Recombinant Desulfotalea psychrophila Protein CrcB homolog (crcB)

Ask
View Details