Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI1C3]
AMM15337VCF 100 µg

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI1C3]

Sign In for Pricing
View Details
Tirofiban-butyl-d9, Hydrochloride (N- (Butyl-d9-sulfonyl) -O-[4- (4-piperidynyl) butyl]-L-tyrosine, Hydrochloride)
T5510-05 1 mg

Tirofiban-butyl-d9, Hydrochloride (N- (Butyl-d9-sulfonyl) -O-[4- (4-piperidynyl) butyl]-L-tyrosine, Hydrochloride)

Sign In for Pricing
View Details
PPP1CB Polyclonal Antibody
E55A02568 100 µg

PPP1CB Polyclonal Antibody

Sign In for Pricing
View Details
GPR68 Protein Vector (Human) (pPM-C-His)
PV052796 500 ng

GPR68 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Tolnaftate 10mM * 1mL in DMSO
A11657-10mM-D 10 mM x 1mL in DMSO

Tolnaftate 10mM * 1mL in DMSO

Sign In for Pricing
View Details
DDAH1 Antibody
orb1261551 100 µL

DDAH1 Antibody

Sign In for Pricing
View Details