HGF Human
Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
Product Specifications
Swiss Prot
P14210
Source
Insect cells.
Buffer
The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.
Storage Conditions
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
E9005-01-PE 100 µL
Exodus 2 (Exodus-2, 6Ckine, Beta Chemokine Exodus-2, Chemokine (C-C Motif) Ligand 21, CCL21, CKb9, ECL, MGC34555, Secondary Lymphoid Tissue Chemokine, SLC, Small Inducible Cytokine A21, SCYA21, TCA4) (PE) discontinued
Ask
View Details 
