HGF Human
Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
Product Specifications
Swiss Prot
P14210
Source
Insect cells.
Buffer
The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.
Storage Conditions
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6215122-01 0.1 mL
Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 550)
Ask
View Details 
MBS6215122-02 5x 0.1 mL
Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 550)
Ask
View Details