HGF Human
Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
Product Specifications
Swiss Prot
P14210
Source
Insect cells.
Buffer
The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.
Storage Conditions
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC229056L4 10 µg
Sodium Potassium ATPase (ATP1A1) (NM_001160234) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details K4384006 1.0 µg DNA
Lig1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 