HGF Human
Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
Product Specifications
Swiss Prot
P14210
Source
Insect cells.
Buffer
The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.
Storage Conditions
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.
Product Datasheet
https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97118
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![MLH1 Recombinant Rabbit Monoclonal Antibody [PD01-61]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82332/imageurl/ha721325.webp)
MBS629829-01 0.2 mL
BRAM1 (Adenovirus 5 E1A Binding Protein, Zinc Finger MYND Domain Containing 11, ZMYND11,Protein BS69, BS69)
Ask
View Details MBS629829-02 5x 0.2 mL
BRAM1 (Adenovirus 5 E1A Binding Protein, Zinc Finger MYND Domain Containing 11, ZMYND11,Protein BS69, BS69)
Ask
View Details