Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF Human

Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.

Product Specifications

Swiss Prot

P14210

Source

Insect cells.

Buffer

The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.

Storage Conditions

Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb
ARM2688-01 30 µL

Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb
ARM2688-02 50 μL

Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb
ARM2688-03 100 µL

Metabotropic Glutamate Receptor 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida purR Protein (aa 1-334)
VAng-Cr7235-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida purR Protein (aa 1-334)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 S Protein Nanobody (SAA1092)
RVV00173 100 μg

Anti-SARS-CoV-2 S Protein Nanobody (SAA1092)

Sign In for Pricing
View Details
CDKL1 AAV Vector (Mouse) (CMV)
15720104 1 µg

CDKL1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details