Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHBP Human

Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton.

Product Specifications

Swiss Prot

P10912

Source

Escherichia Coli.

Buffer

GHBP was lyophilized from a concentrated (1 mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

AFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit
MBS7235888-01 48 Well

Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit

Sign In for Pricing
View Details
Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit
MBS7235888-02 96 Well

Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit

Sign In for Pricing
View Details
Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit
MBS7235888-03 5x 96 Well

Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit

Sign In for Pricing
View Details
Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit
MBS7235888-04 10x 96 Well

Human Anti Luteinizing Hormone Antibody (Anti LH Ab) ELISA Kit

Sign In for Pricing
View Details
DBC1 3'UTR GFP Stable Cell Line
TU055572 1.0 mL

DBC1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse St3gal4 qPCR Primer Pair
QM21022S 200 Tests

Mouse St3gal4 qPCR Primer Pair

Sign In for Pricing
View Details