Chitodextrinase
Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.
Product Specifications
Source
Escherichia Coli.
Buffer
Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
Storage Conditions
Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E4449 96 Tests
Iron-sulfur cluster assembly 1 homolog mitochondrial (ISCA1) Mouse ELISA Kit
Sign In for Pricing
View Details