Chitodextrinase
Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.
Product Specifications
Source
Escherichia Coli.
Buffer
Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
Storage Conditions
Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
044233-PE 200 µL
ZNF43, NT (ZNF43, KOX27, ZNF39, ZNF39L1, Zinc finger protein 43, Zinc finger protein 39, Zinc finger protein HTF6, Zinc finger protein KOX27) (PE) discontinued
Sign In for Pricing
View Details