Chitodextrinase
Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.
Product Specifications
Source
Escherichia Coli.
Buffer
Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
Storage Conditions
Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6480649-01 0.1 mL
Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H
Sign In for Pricing
View Details MBS6480649-02 5x 0.1 mL
Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H
Sign In for Pricing
View Details