Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ME2 Human

ME2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 573 amino acids and having a total molecular mass of 64.4kDa.

Product Specifications

Swiss Prot

P23368

Source

Escherichia Coli.

Buffer

The protein was Lyophilized from a 0.2µm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH8.0.

Storage Conditions

Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KIR3DL2 shRNA Plasmid (h)
sc-105598-SH 20 µg

KIR3DL2 shRNA Plasmid (h)

Ask
View Details
CD4 Antibody (N-term)
MBS9210920-01 0.08 mL

CD4 Antibody (N-term)

Ask
View Details
CD4 Antibody (N-term)
MBS9210920-02 0.4 mL

CD4 Antibody (N-term)

Ask
View Details
CD4 Antibody (N-term)
MBS9210920-03 5x 0.4 mL

CD4 Antibody (N-term)

Ask
View Details
TNFSF14 Antibody
OAAF02025-100UG 100 µg

TNFSF14 Antibody

Ask
View Details
M-phase phosphoprotein 6 (MPHOSPH6) Human ELISA Kit
E8038 96 Tests

M-phase phosphoprotein 6 (MPHOSPH6) Human ELISA Kit

Ask
View Details