UBE2I Human His
Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a 19.5 kDa protein containing 171 amino acids.
Product Specifications
Swiss Prot
P63279
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2I although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2I should be stored at 4°C between 2-7 days and for future use below
Sequence Similarities
MHHHHHHAMGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx321306-01 20 µL
Regulator of G-Protein Signaling 10 (RGS10) Antibody
Sign In for Pricing
View Details abx321306-02 50 µL
Regulator of G-Protein Signaling 10 (RGS10) Antibody
Sign In for Pricing
View Details abx321306-03 100 µL
Regulator of G-Protein Signaling 10 (RGS10) Antibody
Sign In for Pricing
View Details abx321306-04 200 µL
Regulator of G-Protein Signaling 10 (RGS10) Antibody
Sign In for Pricing
View Details abx321306-05 1 mL
Regulator of G-Protein Signaling 10 (RGS10) Antibody
Sign In for Pricing
View Details 
ELK3161-01 48 Tests
Human FGFR4 (Fibroblast Growth Factor Receptor 4) ELISA Kit
Sign In for Pricing
View Details