UBE2I Human His
Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a 19.5 kDa protein containing 171 amino acids.
Product Specifications
Swiss Prot
P63279
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2I although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2I should be stored at 4°C between 2-7 days and for future use below
Sequence Similarities
MHHHHHHAMGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2079121-01 0.1 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details MBS2079121-02 0.2 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details MBS2079121-03 0.5 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details MBS2079121-04 1 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details MBS2079121-05 5 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details MBS2079121-06 5x 5 mL
FITC-Linked Polyclonal Antibody to Thimet Oligopeptidase 1 (THOP1)
Sign In for Pricing
View Details