Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Human His

Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a 19.5 kDa protein containing 171 amino acids.

Product Specifications

Swiss Prot

P63279

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Storage Conditions

Lyophilized UBE2I although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2I should be stored at 4°C between 2-7 days and for future use below

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=73190

Sequence Similarities

MHHHHHHAMGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HOXD8 Polyclonal Antibody, HRP Conjugated
A68584-100 100 µL

HOXD8 Polyclonal Antibody, HRP Conjugated

Ask
View Details
Claudin 2 Monoclonal Antibody, Cy3 Conjugated
bsm-33414M-Cy3 100 µL

Claudin 2 Monoclonal Antibody, Cy3 Conjugated

Ask
View Details
SNORD115-16 CRISPR Knock Out 293T Cell Line (Human)
44738141 1x10<sup>6</sup> cells/1.0ml

SNORD115-16 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
Acetone 99.5%
GPS1003-G 5 L

Acetone 99.5%

Ask
View Details
Rabbit Monoclonal C4.4A/LYPD3 Antibody (213) [CoraFluor 1]
NBP2-89995CL1 0.1 mL

Rabbit Monoclonal C4.4A/LYPD3 Antibody (213) [CoraFluor 1]

Ask
View Details