UBE2I Human His
Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a 19.5 kDa protein containing 171 amino acids.
Product Specifications
Swiss Prot
P63279
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2I although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2I should be stored at 4°C between 2-7 days and for future use below
Sequence Similarities
MHHHHHHAMGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10382636 96 Well
Bovine Gastric Inhibitory Polypeptide ELISA kit
Sign In for Pricing
View Details