Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Human His

Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a 19.5 kDa protein containing 171 amino acids.

Product Specifications

Swiss Prot

P63279

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Storage Conditions

Lyophilized UBE2I although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2I should be stored at 4°C between 2-7 days and for future use below

Sequence Similarities

MHHHHHHAMGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human FAM104A Protein Lysate
MBS8411369-01 0.02 mg

Human FAM104A Protein Lysate

Ask
View Details
Human FAM104A Protein Lysate
MBS8411369-02 5x 0.02 mg

Human FAM104A Protein Lysate

Ask
View Details
Vmn2r108 siRNA Oligos set (Mouse)
49736174 3x 5 nmol

Vmn2r108 siRNA Oligos set (Mouse)

Ask
View Details
DiagNano™ Anti-Human IgG F (ab') 2 Fragment conjugated Gold Nanoparticles, 40 nm
GHF-40-01 0.5 mL

DiagNano™ Anti-Human IgG F (ab') 2 Fragment conjugated Gold Nanoparticles, 40 nm

Ask
View Details
DiagNano™ Anti-Human IgG F (ab') 2 Fragment conjugated Gold Nanoparticles, 40 nm
GHF-40-02 1 mL

DiagNano™ Anti-Human IgG F (ab') 2 Fragment conjugated Gold Nanoparticles, 40 nm

Ask
View Details
Recombinant Brassica oleracea Asparagine synthetase [glutamine-hydrolyzing], partial
MBS1084177-01 0.5 mg (E-Coli)

Recombinant Brassica oleracea Asparagine synthetase [glutamine-hydrolyzing], partial

Ask
View Details