Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2B Human

Ubiquitin Conjugating Enzyme E2B Human Recombinant produced in E.coli is a 19 kDa protein containing 166 amino acids.

Product Specifications

Swiss Prot

P63146

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Sequence Similarities

MHHHHHHAMGQLRSMSTPARRRLMRDFKRLQEDPPVGVSGAPSENN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit
MBS9336659-01 48 Well

Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit

Sign In for Pricing
View Details
Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit
MBS9336659-02 96 Well

Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit

Sign In for Pricing
View Details
Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit
MBS9336659-03 5x 96 Well

Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit

Sign In for Pricing
View Details
Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit
MBS9336659-04 10x 96 Well

Rat POU domain, class 3, transcription factor 4, POU3F4 ELISA Kit

Sign In for Pricing
View Details
Citric acid
C11324-25mg 25 mg

Citric acid

Sign In for Pricing
View Details
Tert-Butyl N-[3- (1-aminocyclopropyl) phenyl]carbamate
PCC76731-01 50 mg

Tert-Butyl N-[3- (1-aminocyclopropyl) phenyl]carbamate

Sign In for Pricing
View Details