UBE2L3 Human His
Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.
Product Specifications
Swiss Prot
P68036
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15314290 1 Vial
Lentiviral human CCDC15 shRNA (UAS) - Lentiviral human CCDC15 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
MBS6170631-01 0.1 mL
BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (Biotin)
Sign In for Pricing
View Details MBS6170631-02 5x 0.1 mL
BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (Biotin)
Sign In for Pricing
View Details 
MBS7090761 Inquire
Recombinant Callithrix geoffroyi Melanocyte-stimulating hormone receptor (MC1R), partial
Sign In for Pricing
View Details