Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 Human His

Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.

Product Specifications

Swiss Prot

P68036

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Storage Conditions

Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal BCL9-2 Antibody [mFluor Violet 450 SE]
NBP1-76542MFV450 0.1 mL

Rabbit Polyclonal BCL9-2 Antibody [mFluor Violet 450 SE]

Ask
View Details
Recombinant Human FAM3B Protein
E30P1716 20 µg

Recombinant Human FAM3B Protein

Ask
View Details
Cullin 4B Antibody
E38PA7281 100 µL

Cullin 4B Antibody

Ask
View Details
Cynomolgus Monkey RBP4 HEK293 Cell Overexpression Lysate
NHFF-0524-HX707 Each

Cynomolgus Monkey RBP4 HEK293 Cell Overexpression Lysate

Ask
View Details
Colony Stimulating Factor Receptor, Granulocyte (GCSFR) Polyclonal Antibody
CAU33539-01 100 µL

Colony Stimulating Factor Receptor, Granulocyte (GCSFR) Polyclonal Antibody

Ask
View Details
Colony Stimulating Factor Receptor, Granulocyte (GCSFR) Polyclonal Antibody
CAU33539-02 200 µL

Colony Stimulating Factor Receptor, Granulocyte (GCSFR) Polyclonal Antibody

Ask
View Details