UBE2L3 Human His
Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.
Product Specifications
Swiss Prot
P68036
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal AIPL1 Antibody [FITC]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
MBS2062641-01 0.1 mL
PE-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)
Ask
View Details MBS2062641-02 0.2 mL
PE-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)
Ask
View Details