UBE2L3 Human His
Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.
Product Specifications
Swiss Prot
P68036
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3219803 1.0 µg DNA
Slc16a5 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 226690-01 50 µL
WDR5 (BIG 3, Big, BIG3, BMP2 induced 3 kb Gene Protein, BMP2 induced Gene, 3-KB, BMP2-induced 3-kb Gene Protein, MGC114572, OTTHUMP00000162494, SWD 3, SWD3, SWD3 Set1c WD40 Repeat Protein Homolog, WD Repeat Containing Protein 5, WD Repeat Domain 5, WD Repeat Protein 5, WD Repeat-Containing Protein 5, WD Repeat-Containing Protein BIG-3, WDR 5, Wdr5, WDR5_HUMAN, ) discontinued
Sign In for Pricing
View Details 226690-02 100 µL
WDR5 (BIG 3, Big, BIG3, BMP2 induced 3 kb Gene Protein, BMP2 induced Gene, 3-KB, BMP2-induced 3-kb Gene Protein, MGC114572, OTTHUMP00000162494, SWD 3, SWD3, SWD3 Set1c WD40 Repeat Protein Homolog, WD Repeat Containing Protein 5, WD Repeat Domain 5, WD Repeat Protein 5, WD Repeat-Containing Protein 5, WD Repeat-Containing Protein BIG-3, WDR 5, Wdr5, WDR5_HUMAN, ) discontinued
Sign In for Pricing
View Details