Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 Human His

Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.

Product Specifications

Swiss Prot

P68036

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Storage Conditions

Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=73130

Sequence Similarities

MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PACSIN3 (NM_016223) Human Over-expression Lysate
LS029763-100ug 100 µg

PACSIN3 (NM_016223) Human Over-expression Lysate

Ask
View Details
Lentiviral mouse Xpa shRNA (UAS) - Lentiviral mouse Xpa shRNA (UAS, iRFP) plasmid
GTR15224584 1 Vial

Lentiviral mouse Xpa shRNA (UAS) - Lentiviral mouse Xpa shRNA (UAS, iRFP) plasmid

Ask
View Details
Bcl G (BCL2L14) Human shRNA Lentiviral Particle (Locus ID 79370)
TL307495V 500 µL Each

Bcl G (BCL2L14) Human shRNA Lentiviral Particle (Locus ID 79370)

Ask
View Details
anti-Tau (Phospho-Ser422)
LF-PA20549 100 ul

anti-Tau (Phospho-Ser422)

Ask
View Details