UBE2L3 Human His
Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.
Product Specifications
Swiss Prot
P68036
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS434057-01 0.05 mg
HIV-1 gp120 (PVO) (Clade B) protein (amino acid 34-518)
Sign In for Pricing
View Details MBS434057-02 5x 0.05 mg
HIV-1 gp120 (PVO) (Clade B) protein (amino acid 34-518)
Sign In for Pricing
View Details NBP2-41361IR 0.1 mL
Rabbit Polyclonal TCP1-delta Antibody [DyLight 755]
Sign In for Pricing
View Details