Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2D Human

Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined) .

Product Specifications

Swiss Prot

Q9UNK4

Source

Escherichia Coli.

Buffer

Sterile filtered and lyophilized from 0.5 mg/mL in 0.05M Acetate buffer pH-4.

Storage Conditions

Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

Sequence Similarities

GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFh-ALP
HY-159485 1 Each

NFh-ALP

Sign In for Pricing
View Details
Biotinylated Human CD305/LAIR1 Protein, C-Avi-His
AHJ05602 100 μg

Biotinylated Human CD305/LAIR1 Protein, C-Avi-His

Sign In for Pricing
View Details
Ift74 3'UTR Luciferase Stable Cell Line
TU109950 1.0 mL

Ift74 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Human CD156b/ADAM17 Antibody (1022C3), APC
FHF68813 100 Tests

Anti-Human CD156b/ADAM17 Antibody (1022C3), APC

Sign In for Pricing
View Details
3D 100 L Single-Use Storage Bag
BIOBGBPPC0100S008 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

3D 100 L Single-Use Storage Bag

Sign In for Pricing
View Details
SIPA1L1 Protein Vector (Rat) (pPM-C-His)
PV305017 500 ng

SIPA1L1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details