PLA2G2D Human
Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined) .
Product Specifications
Swiss Prot
Q9UNK4
Source
Escherichia Coli.
Buffer
Sterile filtered and lyophilized from 0.5 mg/mL in 0.05M Acetate buffer pH-4.
Storage Conditions
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Sequence Similarities
GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035863-ML550 100 µL
GABRG2, ID (GABRG2, Gamma-aminobutyric acid receptor subunit gamma-2, GABA (A) receptor subunit gamma-2) (MaxLight 550) discontinued
Sign In for Pricing
View Details 