Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2D Human

Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined) .

Product Specifications

Swiss Prot

Q9UNK4

Source

Escherichia Coli.

Buffer

Sterile filtered and lyophilized from 0.5 mg/mL in 0.05M Acetate buffer pH-4.

Storage Conditions

Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

Sequence Similarities

GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Blocks, Skin
CB618564 1 Block

Frozen Tissue Blocks, Skin

Ask
View Details
Atp6v0d1 (NM_013477) Mouse Untagged Clone
MC200877 10 µg

Atp6v0d1 (NM_013477) Mouse Untagged Clone

Ask
View Details
Pcdh18 (NM_130448) Mouse Tagged Lenti ORF Clone
MR211684L3 10 µg

Pcdh18 (NM_130448) Mouse Tagged Lenti ORF Clone

Ask
View Details
Rabbit Polyclonal C21orf56 Antibody
NBP1-91032 0.1 mL

Rabbit Polyclonal C21orf56 Antibody

Ask
View Details
Tuberin (Tuberous Sclerosis 2 Protein, TSC2, LAM, TSC4) (MaxLight 650)
134795-ML650 100 µL

Tuberin (Tuberous Sclerosis 2 Protein, TSC2, LAM, TSC4) (MaxLight 650)

Ask
View Details