PLA2G7 Human, HEK
Recombinant Human PLA2G7 produced in HEK293 cells is a polypeptide chain (22-441 a.a), fused to an 8 amino acid His-tag at C-terminus, containing a total of 428 amino acids.
Product Specifications
Swiss Prot
Q13093
Source
HEK293 cells.
Buffer
The PLA2G7 is supplied as a 0.2µm filtered solution in 20mM HAc-NaCl, 150mM NaCl and 10% Glycerol, pH 4.5.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Sequence Similarities
FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPS
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
G2103 96 Tests
Prostaglandin G/H Synthase 2 (PTGS2) Sheep ELISA Kit
Sign In for Pricing
View Details 
43233116 3x 1.0 µg
Sdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details PH319661 10 µg
Junctophilin 2 (JPH2) (NM_020433) Human Mass Spec Standard
Sign In for Pricing
View Details 207768-ML650 100 µL
MAGEA9 (Melanoma Antigen Family A 9, MAGE-9 Antigen, OTTHUMP00000024214, MAGE9, MGC8421, Melanoma-Associated Antigen 9) (MaxLight 650)
Sign In for Pricing
View Details