PLA2G7 Human, HEK
Recombinant Human PLA2G7 produced in HEK293 cells is a polypeptide chain (22-441 a.a), fused to an 8 amino acid His-tag at C-terminus, containing a total of 428 amino acids.
Product Specifications
Swiss Prot
Q13093
Source
HEK293 cells.
Buffer
The PLA2G7 is supplied as a 0.2µm filtered solution in 20mM HAc-NaCl, 150mM NaCl and 10% Glycerol, pH 4.5.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Sequence Similarities
FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPS
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC202064L4V 200 µL
SIAT4A (ST3GAL1) (NM_173344) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS2402172-01 0.05 mL
SCG3/Secretogranin 3 Rabbit anti-Mouse Polyclonal (C-Terminus) Antibody
Sign In for Pricing
View Details 
MBS2402172-02 5x 0.05 mL
SCG3/Secretogranin 3 Rabbit anti-Mouse Polyclonal (C-Terminus) Antibody
Sign In for Pricing
View Details 
K6788506 1.0 µg DNA
Ahcy sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details