MMP 9 Rabbit
MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707) . The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.
Product Specifications
Swiss Prot
P41246
Source
Baculovirus system, insect cells.
Buffer
The MMP-9 solution (0.3mg/mL) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Sequence Similarities
APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R0495-30-ML550 100 µL
Raf Kinase Inhibitor Protein (RKIP) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
TRV-0057843-01 20 µL
Polyclonal Antibody to Sclerostin Domain Containing Protein 1 (SOSTDC1)
Sign In for Pricing
View Details TRV-0057843-02 100 µL
Polyclonal Antibody to Sclerostin Domain Containing Protein 1 (SOSTDC1)
Sign In for Pricing
View Details TRV-0057843-03 200 µL
Polyclonal Antibody to Sclerostin Domain Containing Protein 1 (SOSTDC1)
Sign In for Pricing
View Details TRV-0057843-04 1 mL
Polyclonal Antibody to Sclerostin Domain Containing Protein 1 (SOSTDC1)
Sign In for Pricing
View Details