Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP 9 Rabbit

MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707) . The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.

Product Specifications

Swiss Prot

P41246

Source

Baculovirus system, insect cells.

Buffer

The MMP-9 solution (0.3mg/mL) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

Sequence Similarities

APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR93 ORF Vector (Human) (pORF)
ORF025063 1.0 µg DNA

MIR93 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CID44216842
S6000-25mg 25 mg

CID44216842

Sign In for Pricing
View Details
PICK1 Human Over-expression Lysate
orb1363645 20 µg

PICK1 Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-ERBB3 (Tyr1197) Rabbit Polyclonal Antibody (BF488)
orb2432361 100 µL

Phospho-ERBB3 (Tyr1197) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
MRPL3 Rabbit Polyclonal Antibody (Biotin)
orb2094643 100 µL

MRPL3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Lsamp shRNA (UAS) - Lentiviral mouseLsamp shRNA (UAS, GFP) (25)
GTR15204560 1 Vial

Lentiviral mouse Lsamp shRNA (UAS) - Lentiviral mouseLsamp shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details