TFF1 Human
TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
Product Specifications
Swiss Prot
P04155
Source
Escherichia Coli.
Buffer
The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.
Storage Conditions
Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
252289-ML490 100 µL
SUPT5H (Suppressor of Ty 5 Homolog (S. cerevisiae), FLJ34157, SPT5, SPT5H) (MaxLight 490)
Ask
View Details MBS1464772-01 0.02 mg (E-Coli)
Recombinant Nicotiana tomentosiformis Ribulose bisphosphate carboxylase large chain (rbcL)
Ask
View Details 
MBS1464772-02 0.02 mg (Yeast)
Recombinant Nicotiana tomentosiformis Ribulose bisphosphate carboxylase large chain (rbcL)
Ask
View Details MBS1464772-03 0.1 mg (E-Coli)
Recombinant Nicotiana tomentosiformis Ribulose bisphosphate carboxylase large chain (rbcL)
Ask
View Details 
MBS1464772-04 0.1 mg (Yeast)
Recombinant Nicotiana tomentosiformis Ribulose bisphosphate carboxylase large chain (rbcL)
Ask
View Details MBS1464772-05 0.02 mg (Baculovirus)
Recombinant Nicotiana tomentosiformis Ribulose bisphosphate carboxylase large chain (rbcL)
Ask
View Details