Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF1 Human

TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.

Product Specifications

Swiss Prot

P04155

Source

Escherichia Coli.

Buffer

The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.

Storage Conditions

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

B4GALT3 (B4GALT2) (NM_003780) Human Over-expression Lysate
LC418436 20 µg

B4GALT3 (B4GALT2) (NM_003780) Human Over-expression Lysate

Ask
View Details
HAS3 discontinued
510124 100 µg

HAS3 discontinued

Ask
View Details
RPL26L1 Rabbit monoclonal antibody
BS41434-01 50 µL

RPL26L1 Rabbit monoclonal antibody

Ask
View Details
RPL26L1 Rabbit monoclonal antibody
BS41434-02 100 µL

RPL26L1 Rabbit monoclonal antibody

Ask
View Details
TRIM43B (Tripartite Motif-Containing Protein 43B, TRIM43B) (FITC) discontinued
302810-FITC 200 µL

TRIM43B (Tripartite Motif-Containing Protein 43B, TRIM43B) (FITC) discontinued

Ask
View Details
SAMD13 Adenovirus (Human)
42993051 1.0 mL

SAMD13 Adenovirus (Human)

Ask
View Details