Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF1 Human

TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.

Product Specifications

Swiss Prot

P04155

Source

Escherichia Coli.

Buffer

The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.

Storage Conditions

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hsa-miR-5590-5p miRNA Mimic
CMH1825-01 5 nmol

Hsa-miR-5590-5p miRNA Mimic

Ask
View Details
Hsa-miR-5590-5p miRNA Mimic
CMH1825-02 10 nmol

Hsa-miR-5590-5p miRNA Mimic

Ask
View Details
Rpl34 Mouse qPCR Primer Pair (NM_001005859)
MP222153 200 Reactions

Rpl34 Mouse qPCR Primer Pair (NM_001005859)

Ask
View Details
SEMA4B (NM_020210) Human Recombinant Protein
PH35640M5 20 µg

SEMA4B (NM_020210) Human Recombinant Protein

Ask
View Details
Mouse Tyrosine-protein kinase ABL2, ABL2 ELISA Kit
MBS9325071-01 48 Well

Mouse Tyrosine-protein kinase ABL2, ABL2 ELISA Kit

Ask
View Details
Mouse Tyrosine-protein kinase ABL2, ABL2 ELISA Kit
MBS9325071-02 96 Well

Mouse Tyrosine-protein kinase ABL2, ABL2 ELISA Kit

Ask
View Details