OTOR Human
Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.
Product Specifications
Swiss Prot
Q9NRC9
Source
Escherichia Coli.
Buffer
The OTOR protein was lyophilized from a concentrated (1 mg/mL) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
Storage Conditions
Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1043751-01 0.02 mg (E-Coli)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details MBS1043751-02 0.1 mg (E-Coli)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details MBS1043751-03 0.02 mg (Yeast)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details MBS1043751-04 0.1 mg (Yeast)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details MBS1043751-05 0.02 mg (Baculovirus)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details MBS1043751-06 0.02 mg (Mammalian-Cell)
Recombinant Yersinia pseudotuberculosis serotype O:3 Probable transcriptional regulatory protein YPK_2146 (YPK_2146)
Sign In for Pricing
View Details