Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF Mouse

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.

Product Specifications

Swiss Prot

P09056

Source

Escherichia Coli.

Buffer

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1 mg/mL) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Storage Conditions

Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1, KIAA0035, NOPP130, NOPP140, NS5ATP13, P130) (MaxLight 750) discontinued
249399-ML750 100 µL

NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1, KIAA0035, NOPP130, NOPP140, NS5ATP13, P130) (MaxLight 750) discontinued

Ask
View Details
Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]
MBS3906459-01 0.01 mL

Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]

Ask
View Details
Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]
MBS3906459-02 0.1 mL

Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]

Ask
View Details
Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]
MBS3906459-03 5x 0.01 mL

Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]

Ask
View Details
Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]
MBS3906459-04 5x 0.1 mL

Rabbit anti-NCAM-1/CD56 Recombinant Monoclonal Antibody [BLR152J]

Ask
View Details
Recombinant Bartonella henselae LexA repressor (lexA)
MBS1386228-01 0.02 mg (E-Coli)

Recombinant Bartonella henselae LexA repressor (lexA)

Ask
View Details