Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF Mouse

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.

Product Specifications

Swiss Prot

P09056

Source

Escherichia Coli.

Buffer

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1 mg/mL) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Storage Conditions

Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Coagulation Factor 5 Antigen ELISA Kit
MBS072618 Inquire

Duck Coagulation Factor 5 Antigen ELISA Kit

Sign In for Pricing
View Details
HCV NS3 Antibody
GWB-BB4292 0.25 mg

HCV NS3 Antibody

Sign In for Pricing
View Details
Monoclonal CRP / C-Reactive Protein Antibody
APG02782G 0.1mg

Monoclonal CRP / C-Reactive Protein Antibody

Sign In for Pricing
View Details
Hemoglobin protein (Mouse)
30R-3102 100 mg

Hemoglobin protein (Mouse)

Sign In for Pricing
View Details
Recombinant African swine fever virus Protein MGF 110-13L (War-020), partial
MBS7059170 Inquire

Recombinant African swine fever virus Protein MGF 110-13L (War-020), partial

Sign In for Pricing
View Details
pENTR223-RGR vector Plasmid
PVT11984 2 µg

pENTR223-RGR vector Plasmid

Sign In for Pricing
View Details