Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF Mouse

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.

Product Specifications

Swiss Prot

P09056

Source

Escherichia Coli.

Buffer

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1 mg/mL) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Storage Conditions

Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGCG Protein Vector (Human) (pPM-C-His)
PV045220 500 ng

UGCG Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)
MBS1488076-01 0.02 mg (E-Coli)

Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)
MBS1488076-02 0.1 mg (E-Coli)

Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)
MBS1488076-03 0.02 mg (Yeast)

Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)
MBS1488076-04 0.1 mg (Yeast)

Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)
MBS1488076-05 0.02 mg (Baculovirus)

Recombinant Gluconobacter oxydans Cell division topological specificity factor (minE)

Sign In for Pricing
View Details