Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endoglin Mouse

CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing conditions in SDS-PAGE. Based on N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques.

Product Specifications

Swiss Prot

Q63961

Source

Insect Cells.

Buffer

Endoglin was lyophilized from a concentrated (1 mg/mL) sterile solution containing no additives.

Storage Conditions

Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD105 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVT FTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVF LVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWA ATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTP VQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVS WFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFV ELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMT LALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVV SNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQV SVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSF LLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spock1 Mouse Gene Knockout Kit (CRISPR)
KN516636 1 Kit

Spock1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), 1mg/mL
BNUM3529-50 1x 50 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), 1mg/mL

Sign In for Pricing
View Details
IL17E (IL25) (NM_172314) Human Recombinant Protein
TP320754L 1 mg

IL17E (IL25) (NM_172314) Human Recombinant Protein

Sign In for Pricing
View Details
RPL26 Rabbit Polyclonal Antibody
HA500532 100 µL

RPL26 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C10orf71 activation kit by CRISPRa
GA114661 1 Kit

Human C10orf71 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Ethoxy-6,9-diaminoacridine Lactate
TRC-E261505-5G 5 g

2-Ethoxy-6,9-diaminoacridine Lactate

Sign In for Pricing
View Details