What is the catalog number for IFN a 2b Human?

The catalog number for IFN a 2b Human is OM297260.

What sizes are available for IFN a 2b Human?

IFN a 2b Human is available in the following size(s): 100 µg, 20 µg, 1 mg.

How many pack sizes does IFN a 2b Human come in?

IFN a 2b Human is available in 3 different pack sizes.

Is IFN a 2b Human in stock?

IFN a 2b Human is currently made to order / not held in immediate stock. Contact us for lead time.

IFN a 2b Human

Interferon-a 2b Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton.

Product Specifications

Swiss Prot

Q86UP4

Source

Escherichia Coli.

Buffer

Lyophilized from a (1 mg/mL) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer.

Storage Conditions

Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN alpha 2b should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.