Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBI3 Human

EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.

Product Specifications

Swiss Prot

Q14213

Source

Escherichia Coli.

Buffer

EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.

Storage Conditions

Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sequence Similarities

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vstm5 Mouse siRNA Oligo Duplex (Locus ID 69137)
SR405054 1 Kit

Vstm5 Mouse siRNA Oligo Duplex (Locus ID 69137)

Ask
View Details
Recombinant Human CACNG3 Protein, N-GST & C-His
E55P7612 50 µg

Recombinant Human CACNG3 Protein, N-GST & C-His

Ask
View Details
Human CK-MB Matched Antibody Pair Set [ABP-S-05769]
ABP-S-05769 5 Plates

Human CK-MB Matched Antibody Pair Set [ABP-S-05769]

Ask
View Details
Rabbit Polyclonal PSF1 Antibody [Alexa Fluor 700]
NBP2-32156AF700 0.1 mL

Rabbit Polyclonal PSF1 Antibody [Alexa Fluor 700]

Ask
View Details