EBI3 Human
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
Product Specifications
Swiss Prot
Q14213
Source
Escherichia Coli.
Buffer
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Sequence Similarities
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2858811 100 µL
Phospho-RPS6KB1 (Ser441+Thr444) Rabbit pAb, BF700 conjugated
Sign In for Pricing
View Details 
P6300-28F-ML650 100 µL
Presenilin 1, CT (Presenilin-1, PS-1, Protein S182, Presenilin-1 NTF Subunit, Presenilin-1 CTF Subunit, Presenilin-1 CTF12, PS1-CTF12, AD3, PS1, PSNL1, PSEN1) (MaxLight 650) discontinued
Sign In for Pricing
View Details 035860-PE 200 µL
GABRB2, CT (GABRB2, Gamma-aminobutyric acid receptor subunit beta-2, GABA (A) receptor subunit beta-2) (PE) discontinued
Sign In for Pricing
View Details