EBI3 Human
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
Product Specifications
Swiss Prot
Q14213
Source
Escherichia Coli.
Buffer
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Sequence Similarities
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6135676-01 0.1 mL
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) APC
Ask
View Details 
MBS6135676-02 5x 0.1 mL
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) APC
Ask
View Details 
MBS6271181-01 0.2 mL
ACSS2, NT (ACSS2, ACAS2, Acetyl-coenzyme A synthetase, cytoplasmic, Acetate-CoA ligase, Acetyl-CoA synthetase, Acyl-CoA synthetase short-chain family member 2, Acyl-activating enzyme) (FITC)
Ask
View Details MBS6271181-02 5x 0.2 mL
ACSS2, NT (ACSS2, ACAS2, Acetyl-coenzyme A synthetase, cytoplasmic, Acetate-CoA ligase, Acetyl-CoA synthetase, Acyl-CoA synthetase short-chain family member 2, Acyl-activating enzyme) (FITC)
Ask
View Details 
292216-01 5 g
4-Hydroxy-2-methyl-2H-1,2-benzothiazine-3-carboxylic acid, ethyl ester 1,1-Dioxide
Ask
View Details