EBI3 Human
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
Product Specifications
Swiss Prot
Q14213
Source
Escherichia Coli.
Buffer
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Sequence Similarities
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
029428 100 µg
BMPR1B (Bone Morphogenetic Protein Receptor Type-1B, BMP Type-1B Receptor, BMPR-1B, CDw293) discontinued
Sign In for Pricing
View Details 