Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBI3 Human

EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.

Product Specifications

Swiss Prot

Q14213

Source

Escherichia Coli.

Buffer

EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.

Storage Conditions

Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sequence Similarities

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV Pret-030 Protein (aa 1-357)
VAng-2322Lsx-50g 50 µg

Recombinant ASFV Pret-030 Protein (aa 1-357)

Sign In for Pricing
View Details
Mdm4 (NM_001012026) Rat Tagged ORF Clone
RR210484 10 µg

Mdm4 (NM_001012026) Rat Tagged ORF Clone

Sign In for Pricing
View Details
MED4 Rabbit mAb
E45R11299N-100 100 µL

MED4 Rabbit mAb

Sign In for Pricing
View Details
PELI1 Antibody
A65968-100UL 100 µL

PELI1 Antibody

Sign In for Pricing
View Details
P2RX4 (P2X Purinoceptor 4, P2X4, P2X4R) (MaxLight 550)
MBS6448204-01 0.1 mL

P2RX4 (P2X Purinoceptor 4, P2X4, P2X4R) (MaxLight 550)

Sign In for Pricing
View Details
P2RX4 (P2X Purinoceptor 4, P2X4, P2X4R) (MaxLight 550)
MBS6448204-02 5x 0.1 mL

P2RX4 (P2X Purinoceptor 4, P2X4, P2X4R) (MaxLight 550)

Sign In for Pricing
View Details