Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBI3 Human

EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.

Product Specifications

Swiss Prot

Q14213

Source

Escherichia Coli.

Buffer

EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.

Storage Conditions

Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sequence Similarities

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFATC4 Polyclonal Antibody, RBITC Conjugated
bs-6461R-RBITC 100 µL

NFATC4 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit
MBS7240113-01 48 Well

Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit

Ask
View Details
Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit
MBS7240113-02 96 Well

Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit

Ask
View Details
Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit
MBS7240113-03 5x 96 Well

Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit

Ask
View Details
Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit
MBS7240113-04 10x 96 Well

Porcine Ankyrin repeat domain-containing protein 56 (ANKRD56) ELISA Kit

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) XXT2 Polyclonal Antibody
MBS7181388 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) XXT2 Polyclonal Antibody

Ask
View Details