TNF a Human, HEK
TNF-a Human Recombinant produced in HEK cells is a glycosylated non-disulfide linked homotrimer, containing 157 and having total Mw of 17kDa.
Product Specifications
Swiss Prot
P01375
Source
HEK.
Buffer
The TNF-a protein was lyophilized from 1 mg/mL in 1xPBS.
Storage Conditions
Lyophilized TNF-a although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TNF-a should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9394051-01 48 Well
Porcine RNA Polymerase II Elongation Factor ELL3 (ELL3) ELISA Kit
Sign In for Pricing
View Details