TNF a Human, HEK
TNF-a Human Recombinant produced in HEK cells is a glycosylated non-disulfide linked homotrimer, containing 157 and having total Mw of 17kDa.
Product Specifications
Swiss Prot
P01375
Source
HEK.
Buffer
The TNF-a protein was lyophilized from 1 mg/mL in 1xPBS.
Storage Conditions
Lyophilized TNF-a although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TNF-a should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR201848L3V 200 µL
Rpl9 (BC083166) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details