Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFR2 Human, His

TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P20333

Source

Escherichia Coli.

Buffer

TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPDL3B (NM_001009568) Human Recombinant Protein
TP304846M 100 µg

SMPDL3B (NM_001009568) Human Recombinant Protein

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Fragment
RAF-311-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Fragment

Sign In for Pricing
View Details
Mavacamten-d7
TRC-M299811-5MG 5 mg

Mavacamten-d7

Sign In for Pricing
View Details
Human BROX activation kit by CRISPRa
GA115671 1 Kit

Human BROX activation kit by CRISPRa

Sign In for Pricing
View Details
CA13 Rabbit Polyclonal Antibody
TA374170 100 µL

CA13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL
BNC681588-500 1x 500 µL

CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details