Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFR2 Human, His

TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P20333

Source

Escherichia Coli.

Buffer

TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPEL2 Human Gene Knockout Kit (CRISPR)
KN422853 1 Kit

YPEL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ELOA2 activation kit by CRISPRa
GA109657 1 Kit

Human ELOA2 activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Human CD39 Antibody[A1]
E-AB-F1165E-01 20 Tests

APC Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
APC Anti-Human CD39 Antibody[A1]
E-AB-F1165E-02 100 Tests

APC Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
APC Anti-Human CD39 Antibody[A1]
E-AB-F1165E-03 2x 100 Tests

APC Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B3]
TA811754AM 100 µL

RWDD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B3]

Sign In for Pricing
View Details