TNFR2 Human, His
TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.
Product Specifications
Swiss Prot
P20333
Source
Escherichia Coli.
Buffer
TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks.
Sequence Similarities
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882117-100 1x 100 µL
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 