Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFR2 Human, His

TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P20333

Source

Escherichia Coli.

Buffer

TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase p85 alpha Mouse Monoclonal Antibody [A3-D0]
M1510-2 100 µL

PI 3 Kinase p85 alpha Mouse Monoclonal Antibody [A3-D0]

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS625215 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
TyraMaxTM 680/700 Amplification Dye, 100X
#96143-100UL 1x 100 µL

TyraMaxTM 680/700 Amplification Dye, 100X

Sign In for Pricing
View Details
SLC24A4 Rabbit Polyclonal Antibody
TA381591 100 µL

SLC24A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBA2 Rabbit Polyclonal Antibody
TA376500 100 µL

GBA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human BVES/POPDC1 Protein (GST Tag)
PKSH030823 100 µg

Recombinant Human BVES/POPDC1 Protein (GST Tag)

Sign In for Pricing
View Details