Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP Human

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C

Product Specifications

Swiss Prot

P16860

Buffer

The protein was lyophilized without additives.

Storage Conditions

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrocarpal L
380751 5 mg

Macrocarpal L

Sign In for Pricing
View Details
FBXO32 Conjugated Antibody
orb1619853 100 µL

FBXO32 Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (019) [DyLight 550]
NBP3-12735R 100 µL

Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (019) [DyLight 550]

Sign In for Pricing
View Details
UPF3A CRISPR Knock Out 293T Cell Line (Human)
49208141 1x 10^6 Cells / 1.0 mL

UPF3A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Uridine Phosphorylase 1 Rabbit Polyclonal Antibody (PE)
orb484288 100 µL

Uridine Phosphorylase 1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
AF-10 (HAF10 10D3/8) : m-IgG2a BP-HRP Bundle
sc-547895 1 Kit

AF-10 (HAF10 10D3/8) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details