Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP Human

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C

Product Specifications

Swiss Prot

P16860

Buffer

The protein was lyophilized without additives.

Storage Conditions

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody
CAU33628-01 100 µL

Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody

Sign In for Pricing
View Details
Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody
CAU33628-02 200 µL

Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody

Sign In for Pricing
View Details
Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody
CAU33628-03 1 mL

Glucagon Like Peptide 1 (GLP1) Monoclonal Antibody

Sign In for Pricing
View Details
C1orf127 Protein Lysate (Human) with C-Ha Tag
14129031 100 µg

C1orf127 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
HES1 siRNA (Human)
MBS8222907-01 15 nmol

HES1 siRNA (Human)

Sign In for Pricing
View Details
HES1 siRNA (Human)
MBS8222907-02 30 nmol

HES1 siRNA (Human)

Sign In for Pricing
View Details