BNP Human
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C
Product Specifications
Swiss Prot
P16860
Buffer
The protein was lyophilized without additives.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
036606-ML405 100 µL
HIST3H3, ID (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 405) discontinued
Ask
View Details 
