Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP Human

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C

Product Specifications

Swiss Prot

P16860

Buffer

The protein was lyophilized without additives.

Storage Conditions

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motilin receptor (MLNR) (NM_001507) Human Over-expression Lysate
LS002862-20ug 20 µg

Motilin receptor (MLNR) (NM_001507) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Protein FAM166A (FAM166A)
MBS1435496-01 0.02 mg (E-Coli)

Recombinant Human Protein FAM166A (FAM166A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM166A (FAM166A)
MBS1435496-02 0.02 mg (Yeast)

Recombinant Human Protein FAM166A (FAM166A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM166A (FAM166A)
MBS1435496-03 0.1 mg (E-Coli)

Recombinant Human Protein FAM166A (FAM166A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM166A (FAM166A)
MBS1435496-04 0.1 mg (Yeast)

Recombinant Human Protein FAM166A (FAM166A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM166A (FAM166A)
MBS1435496-05 0.02 mg (Baculovirus)

Recombinant Human Protein FAM166A (FAM166A)

Sign In for Pricing
View Details