BNP Human
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C
Product Specifications
Swiss Prot
P16860
Buffer
The protein was lyophilized without additives.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
GTR15255131 1 Vial
Lentiviral mouse Cdc73 shRNA (UAS) - Lentiviral mouse Cdc73 shRNA (UAS, RFP) (25)
Ask
View Details 
248452-ML405 100 µL
MAP3K4 (Mitogen-Activated Protein Kinase Kinase Kinase 4, FLJ42439, KIAA0213, MAPKKK4, MEKK4, MTK1, PRO0412) (MaxLight 405) discontinued
Ask
View Details 
QP10270-ec-20ug 20ug
Recombinant Mouse CCL11/ Eotaxin Protein, Untagged, E.coli-20ug
Ask
View Details