BNP Human
B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
Product Specifications
Swiss Prot
P16860
Source
Escherichia Coli.
Buffer
Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9911891 Inquire
Pigeon Stromal Interaction Molecule 2 (STIM2) ELISA Kit
Sign In for Pricing
View Details 
OAAF04412-100UG-Biotin 100 µg
USP40 Antibody : Biotin (OAAF04412-Biotin)
Sign In for Pricing
View Details K0566507 1.0 µg DNA
DCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details NB-E11476-01 96 Well
Human peptide major histocompatibility complex, pMHC ELISA Kit
Sign In for Pricing
View Details NB-E11476-02 96 Well
Human peptide major histocompatibility complex, pMHC ELISA Kit
Sign In for Pricing
View Details