BNP Human
B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
Product Specifications
Swiss Prot
P16860
Source
Escherichia Coli.
Buffer
Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7172992 Inquire
Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) ASTB Polyclonal Antibody
Sign In for Pricing
View Details MBS9014697 Inquire
Rabbit anti-Caenorhabditis elegans tbh-1 Polyclonal Antibody
Sign In for Pricing
View Details 